PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01680.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 339aa    MW: 39156.7 Da    PI: 6.943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01680.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.1e-14130175248
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              g W + Ed  l  +v+++G+++Wk Ia ++g +R +kqc++rw+++l
  Rsa1.0_01680.1_g00002.1 130 GGWDQTEDINLRILVELYGTKNWKQIATMLG-TRIGKQCRERWHNHL 175
                              67*****************************.*************97 PP

2Myb_DNA-binding50.54.8e-16181223145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +++WT+ Ed++lv+a+k +G++ W++Ia ++  gRt++ +k+rw+
  Rsa1.0_01680.1_g00002.1 181 KNAWTEKEDQILVEAHKAFGNK-WTKIALKLH-GRTENAIKNRWN 223
                              689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.692124179IPR017930Myb domain
SuperFamilySSF466895.99E-27128222IPR009057Homeodomain-like
SMARTSM007172.9E-11128177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-19131180IPR009057Homeodomain-like
CDDcd001671.13E-11132175No hitNo description
PfamPF139211.3E-14132189No hitNo description
PROSITE profilePS5129419.426180230IPR017930Myb domain
SMARTSM007174.2E-15180228IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-20181228IPR009057Homeodomain-like
CDDcd001672.98E-11183226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDYSLNIFNK NFTRNETGNS LPSDDLSYLK KDHINCFNDY LGQSSVNGWS NSSIMTSNSD  60
PNYQSPISVM PNQNYDPFSR SFVFTQNFPA FNSLIPEIPP RYPFIDIDLE KNNKVAKRNK  120
ALTENNFNTG GWDQTEDINL RILVELYGTK NWKQIATMLG TRIGKQCRER WHNHLRHGIK  180
KNAWTEKEDQ ILVEAHKAFG NKWTKIALKL HGRTENAIKN RWNATKRRMH FMKMKQSDKN  240
ANPPQNVILA GYIRHVTNKN ESPNTKETDC TKNDDYDNAF DGEMDLSLGV TTQNTEPLAS  300
MSTTSCYVPE PATTFSWDDY ITNVCESKDD FDMIMQGWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-321302285103C-Myb DNA-Binding Domain
1mse_C1e-321302285103C-Myb DNA-Binding Domain
1a5j_A2e-321302288106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140005.11e-154PREDICTED: transcription factor MYB98-like
TrEMBLA0A0D3C0680.0A0A0D3C068_BRAOL; Uncharacterized protein
STRINGBra025564.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133031427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.14e-55myb domain protein 115